PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.L0YAL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 236aa    MW: 25832.3 Da    PI: 6.5123
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.L0YALgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.14.8e-34125179155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+rlrWt++LHerFv+av+qLGGs++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Araip.L0YAL 125 KQRLRWTNDLHERFVDAVAQLGGSDRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 179
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.005122182IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-32124180IPR009057Homeodomain-like
SuperFamilySSF466896.99E-18124179IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-26125180IPR006447Myb domain, plants
PfamPF002493.3E-9127178IPR001005SANT/Myb domain
PfamPF143795.3E-10211233IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MPREEGSKGT EEEGVTVYAR KKRSESEIEG TPGWPTVPPN STTVLTMSIE LQSLSCLVGS  60
GDANASTGPT IITPNSVFFS LFYINDKCIT QTTLLPRNSL VCDHPMDCVA TAMDLVNGGN  120
SLASKQRLRW TNDLHERFVD AVAQLGGSDR ATPKGVLRVM GVQGLTIYHV KSHLQKYRLA  180
KYLPGSSTDG KNAEKKETED VLSNLDGSSG MQITEALKLQ MEVQKRLHEQ LEVIHI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0952942e-92BT095294.1 Soybean clone JCVI-FLGm-7I11 unknown mRNA.
GenBankBT0958122e-92BT095812.1 Soybean clone JCVI-FLGm-25I12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015940282.14e-94PREDICTED: uncharacterized protein LOC107465818 isoform X1
RefseqXP_015940285.14e-94PREDICTED: uncharacterized protein LOC107465818 isoform X1
RefseqXP_015940289.14e-94PREDICTED: uncharacterized protein LOC107465818 isoform X1
RefseqXP_015940293.14e-94PREDICTED: uncharacterized protein LOC107465818 isoform X1
SwissprotQ8GUN51e-40PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0D2UKC23e-75A0A0D2UKC2_G
STRINGVIT_00s0475g00040.t015e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106592535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.16e-68G2-like family protein